|
|
|
Stresscopin (3-40) (human) trifluoroacetate salt
Synonyms: urocortin iii human | stresscopin (3-40) (human) | l-isoleucinamide,l-phenylalanyl-l-threonyl-l-leucyl-l-seryl-l-leucyl-l-a-aspartyl-l-valyl-l-prolyl-l-threonyl-l-asparaginyl-l-isoleucyl-l-methionyl-l-asparaginyl-l-leucyl-l-leucyl-l-phenylalanyl-l-asparaginyl-l-isoleucyl-l-alanyl-l-lysyl-l-alanyl-l-lysyl-l-asparaginyl-l-leucyl-l-arginyl-l-alanyl-l-glutaminyl-l-alanyl-l-alanyl-l-alanyl-l-asparaginyl-l-alanyl-l-histidyl-l-leucyl-l-methionyl-l-alanyl-l-glutaminyl- | urocortin iii (human) trifluoroacetate salt | stresscopin (3-40) (human) trifluoroacetate salt | h-phe-thr-leu-ser-leu-asp-val-pro-thr-asn-ile-met-asn-leu-leu-phe-asn-ile-ala-lys-ala-lys-asn-leu-arg-ala-gln-ala-ala-ala-asn-ala-his-leu-met-ala-gln-ile-nh2 | humanurocortin 3 | thr-lys-phe-thr-leu-ser-leu-asp-val-pro-thr-asn-ile-met-asn-leu-leu-phe-asn-ile-ala-lys-ala-lys-asn-leu-arg-ala-gln-ala-ala-ala-asn-ala-his-leu-met-ala-gln-ile-nh2 trifluoroacetate salt | phe-thr-leu-ser-leu-asp-val-pro-thr-asn-ile-met-asn-leu-leu-phe-asn-ile-ala-lys-ala-lys-asn-leu-arg-ala-gln-ala-ala-ala-asn-ala-his-leu-met-ala-gln-ile-nh2 | human urocortiniii | stresscopin trifluoroacetate salt human | ftlsldvptnimnllfniakaknlraqaaanahlmaqi-nh2
Formula: C185H307 N53 O50 S2
List of Suppliers
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is supplier for Stresscopin (3-40) (human) trifluoroacetate salt.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. 3-(1-Ethylpropyl)-1-phenyl-1H-1,2,4-triazol-5(4H)-one will be also provided by us.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Specification
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Calcium carbonate, Pharma
Suppliers and manufactures - with identical CAS number as Stresscopin (3-40) (human) trifluoroacetate salt
For the following products supplier are listed below:
Urocortin III (human)
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. We supply our chemical product Lys(Dabsyl)-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
|
|
|
How do you find
new customers?
click here
Chengdu Pufeide Biotech
Chengdu Pufeide Biotech. Co., Ltd. is a leading supplier of natural pure plant monomers at home and
Prakash Chemicals Inter
Prakash Chemicals International Pvt. Ltd. (PCIPL) today, stands as an archetype of unmatched qualit
Lori Industry Co., Ltd
Lori industry Co., Ltd was established in 2002 years. It is a large-scale manufacturer integrating
Qingdao QY Liquid Cryst
15 years of PDLC liquid crystal production experience. Qingdao QY Liquid Crystal Co., Ltd. is a pr
PeptART Bioscience GmbH
PeptART Bioscience GmbH is a 100% Swiss company with its own manufacturing facilities in Switzerlan
Suzhou Bichal Biologica
SUZHOU BICHAL BIOLOGICAL TECHNOLOGY CO., LTD is a fast-growing pharmaceutical company that engages
|
